PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00006607-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NF-YB
Protein Properties Length: 197aa    MW: 19943.1 Da    PI: 7.5025
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00006607-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.61.8e-5819114297
                  NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 
                            reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe+yveplkvyl+k
  SMil_00006607-RA_Salv  19 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLAK 106
                            89************************************************************************************** PP

                  NF-YB  90 yrelegek 97 
                            yre+egek
  SMil_00006607-RA_Salv 107 YREMEGEK 114
                            ******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.0E-5513122IPR009072Histone-fold
SuperFamilySSF471131.71E-4021119IPR009072Histone-fold
PfamPF008086.5E-282488IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.2E-215270No hitNo description
PROSITE patternPS0068505571IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.2E-217189No hitNo description
PRINTSPR006152.2E-2190108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MADSDNDSGG HSNSNASSRE QDRFLPIANV SRIMKKALPA NAKISKDAKE TVQECVSEFI  60
SFVTGEASDK CQREKRKTIN GDDLLWAMTT LGFEEYVEPL KVYLAKYREM EGEKSSIAGV  120
KEGGGGGGGG GAVSSGAGFN GGGIYGGNVM GFHPGGQMYG GGGAGGGGFQ HMGKGGLGNM  180
GGGGGYGGGG ASTGRPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4919109292Transcription factor HapC (Eurofung)
4g92_B2e-4919109292Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0893465e-84BT089346.1 Soybean clone JCVI-FLGm-1B8 unknown mRNA.
GenBankKT0311585e-84KT031158.1 Glycine max clone HN_CCL_197 CCAAT transcription factor (Glyma15g12570.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100345.14e-94PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233104e-78NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A022QLU93e-87A0A022QLU9_ERYGU; Uncharacterized protein
STRINGVIT_19s0015g00440.t015e-80(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.19e-68nuclear factor Y, subunit B3